PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024799P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 285aa    MW: 30740.4 Da    PI: 8.4722
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024799P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.7e-19954147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
   MELO3C024799P1  9 KGPWSPEEDDALQRLVHKYGPRNWSLISKSIP-GRSGKSCRLRWCNQ 54
                     79******************************.***********985 PP

2Myb_DNA-binding54.13.5e-1763105347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a +++G++ W+tIar +  gRt++ +k++w++ 
   MELO3C024799P1  63 AFTPEEDETIINAQALYGNK-WATIARLLS-GRTDNAIKNHWNST 105
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.114459IPR017930Myb domain
SuperFamilySSF466891.08E-316102IPR009057Homeodomain-like
SMARTSM007171.4E-17857IPR001005SANT/Myb domain
PfamPF002493.0E-19954IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-261062IPR009057Homeodomain-like
CDDcd001673.96E-171153No hitNo description
SMARTSM007172.7E-1460108IPR001005SANT/Myb domain
PROSITE profilePS5129421.23861110IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2263109IPR009057Homeodomain-like
PfamPF002494.9E-1463105IPR001005SANT/Myb domain
CDDcd001675.49E-1263106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MAKQIDRIKG PWSPEEDDAL QRLVHKYGPR NWSLISKSIP GRSGKSCRLR WCNQLSPQVE  60
HRAFTPEEDE TIINAQALYG NKWATIARLL SGRTDNAIKN HWNSTLKRKC SSMADESGGC  120
DATSPPLKRS LSAGLYMPPN SPSASDVSDS GFFPAVSSSH VYRPVARTGA VLPPGETVSS  180
SNDPPTSLSL SLPGADSSEV NFVANSAQGM GGVSERRREK EESNSNGFGI FGSDLMTVMQ  240
EMIRKEVRNY MAGLMEQNVG GGGGVCYQQA AAGGFRNVVI QRID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3961124110B-MYB
1mse_C2e-3981103105C-Myb DNA-Binding Domain
1msf_C2e-3981103105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819150.0LN681915.1 Cucumis melo genomic scaffold, anchoredscaffold00070.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462845.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-89MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0LTE40.0A0A0A0LTE4_CUCSA; Uncharacterized protein
STRINGVIT_07s0129g01050.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.15e-92myb domain protein 73